PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G136500.2.p
Common NameSb07g021210, SORBIDRAFT_07g021210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 357aa    MW: 39639.2 Da    PI: 6.2752
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G136500.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.3e-171461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd++l+  ++++G g+W++ +++ g+ R++k+c++rw +yl
  Sobic.007G136500.2.p 14 KGPWTPEEDQKLLAFIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNYL 61
                          79********************************************97 PP

2Myb_DNA-binding54.23.2e-1767112148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  Sobic.007G136500.2.p  67 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-NRTDNEIKNYWNTHL 112
                           89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.612961IPR017930Myb domain
SuperFamilySSF466899.36E-3111108IPR009057Homeodomain-like
SMARTSM007174.2E-141363IPR001005SANT/Myb domain
PfamPF002493.0E-161461IPR001005SANT/Myb domain
CDDcd001674.42E-111661No hitNo description
PROSITE profilePS5129426.42362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2665116IPR009057Homeodomain-like
SMARTSM007174.5E-1766114IPR001005SANT/Myb domain
PfamPF002491.6E-1667112IPR001005SANT/Myb domain
CDDcd001672.51E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010091Biological Processtrichome branching
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MGRSPCCEKI GLKKGPWTPE EDQKLLAFIE EHGHGSWRAL PAKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIATHLPNRT DNEIKNYWNT HLKKRLAKMG  120
IDPVTHKSLS GTLTGTTNNK SAKAAASLSH MAQWESARLE AEARLARESK IRTATPTPTA  180
LHAQPTNVPA SAASPCLDVL HGWQGAKIDL ESPTSTLTFT GSNSGMLPTP RTNRLEVSES  240
NSVMWHQRSD ELEGEENDWQ IFSKHQVLEL DSKEREDDFI GCEEPWFSGM AGVGSGFTSM  300
LFDVSNEHDA SECWGESNNG HTEHSNQASD EEDKNYWNGV LDMVNSELTP QSPPLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7283140.0KJ728314.1 Zea mays clone pUT6594 MYB transcription factor (MYB28) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002444392.10.0hypothetical protein SORBIDRAFT_07g021210
TrEMBLC5YL800.0C5YL80_SORBI; Putative uncharacterized protein Sb07g021210
STRINGSb07g021210.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56093758
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.13e-94myb domain protein 106